Lnpep/ Rat Lnpep ELISA Kit
ELI-43182r	Lifescience Market	96 Tests	EUR 1063.2

Human Monoclonal Laboratories manufactures the anti- human lnpep monoclonal reagents distributed by Genprice. The Anti- Human Lnpep Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Anti- products are available in stock. Specificity: Anti- Category: Human Group: Lnpep Monoclonal

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Lnpep Monoclonal information

FITC*Monoclonal Mouse Anti- Human IgM
C030601-1ml	Unibiotest	1ml	EUR 424.8

FITC*Monoclonal Mouse Anti- Human Fab
C030603-10ml	Unibiotest	10ml	EUR 2148

FITC*Monoclonal Mouse Anti- Human Fab
C030603-1ml	Unibiotest	1ml	EUR 424.8

FITC*Monoclonal Mouse Anti- Human IgA
C030649-10ml	Unibiotest	10ml	EUR 2148

FITC*Monoclonal Mouse Anti- Human IgA
C030649-1ml	Unibiotest	1ml	EUR 373.2

Human LNPEP shRNA Plasmid
20-abx952716	Abbexa	EUR 961.20 EUR 1345.20	150 µg 300 µg

FITC*Monoclonal Mouse Anti- Human IgG2
C030645-10ml	Unibiotest	10ml	EUR 3162

FITC*Monoclonal Mouse Anti- Human IgG2
C030645-1ml	Unibiotest	1ml	EUR 525.6

FITC*Monoclonal Mouse Anti- Human IgG3
C030646-10ml	Unibiotest	10ml	EUR 3162

FITC*Monoclonal Mouse Anti- Human IgG3
C030646-1ml	Unibiotest	1ml	EUR 525.6

FITC*Monoclonal Mouse Anti- Human IgG4
C030647-10ml	Unibiotest	10ml	EUR 3162

FITC*Monoclonal Mouse Anti- Human IgG4
C030647-1ml	Unibiotest	1ml	EUR 525.6

FITC*Monoclonal Mouse Anti- Human IgG1
C030648-10ml	Unibiotest	10ml	EUR 3162

FITC*Monoclonal Mouse Anti- Human IgG1
C030648-1ml	Unibiotest	1ml	EUR 525.6

BIOTIN*Monoclonal Mouse Anti- Human FC
C030802-10ml	Unibiotest	10ml	EUR 2148

BIOTIN*Monoclonal Mouse Anti- Human FC
C030802-1ml	Unibiotest	1ml	EUR 373.2

Rat Anti Human Cd8 Monoclonal Antibody
CABT-45277RH	Creative Diagnostics	0.2 mg	EUR 889.2