Human Monoclonal Laboratories manufactures the anti- human lnpep monoclonal reagents distributed by Genprice. The Anti- Human Lnpep Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Anti- products are available in stock. Specificity: Anti- Category: Human Group: Lnpep Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 482.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Lnpep Monoclonal information
FITC*Monoclonal Mouse Anti- Human IgM |
C030601-1ml |
Unibiotest |
1ml |
EUR 424.8 |
FITC*Monoclonal Mouse Anti- Human Fab |
C030603-10ml |
Unibiotest |
10ml |
EUR 2148 |
FITC*Monoclonal Mouse Anti- Human Fab |
C030603-1ml |
Unibiotest |
1ml |
EUR 424.8 |
FITC*Monoclonal Mouse Anti- Human IgA |
C030649-10ml |
Unibiotest |
10ml |
EUR 2148 |
FITC*Monoclonal Mouse Anti- Human IgA |
C030649-1ml |
Unibiotest |
1ml |
EUR 373.2 |
Human LNPEP shRNA Plasmid |
20-abx952716 |
Abbexa |
|
|
|
FITC*Monoclonal Mouse Anti- Human IgG2 |
C030645-10ml |
Unibiotest |
10ml |
EUR 3162 |
FITC*Monoclonal Mouse Anti- Human IgG2 |
C030645-1ml |
Unibiotest |
1ml |
EUR 525.6 |
FITC*Monoclonal Mouse Anti- Human IgG3 |
C030646-10ml |
Unibiotest |
10ml |
EUR 3162 |
FITC*Monoclonal Mouse Anti- Human IgG3 |
C030646-1ml |
Unibiotest |
1ml |
EUR 525.6 |
FITC*Monoclonal Mouse Anti- Human IgG4 |
C030647-10ml |
Unibiotest |
10ml |
EUR 3162 |
FITC*Monoclonal Mouse Anti- Human IgG4 |
C030647-1ml |
Unibiotest |
1ml |
EUR 525.6 |
FITC*Monoclonal Mouse Anti- Human IgG1 |
C030648-10ml |
Unibiotest |
10ml |
EUR 3162 |
FITC*Monoclonal Mouse Anti- Human IgG1 |
C030648-1ml |
Unibiotest |
1ml |
EUR 525.6 |
BIOTIN*Monoclonal Mouse Anti- Human FC |
C030802-10ml |
Unibiotest |
10ml |
EUR 2148 |
BIOTIN*Monoclonal Mouse Anti- Human FC |
C030802-1ml |
Unibiotest |
1ml |
EUR 373.2 |