Fibroblast growth factor 4

FGF receptors (FGFRs) are involved in the pathogenesis

fallback-image

Anti- Human Lnpep Monoclonal

Lnpep/ Rat Lnpep ELISA Kit

ELI-43182r 96 Tests
EUR 1063.2

Human Monoclonal Laboratories manufactures the anti- human lnpep monoclonal reagents distributed by Genprice. The Anti- Human Lnpep Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Anti- products are available in stock. Specificity: Anti- Category: Human Group: Lnpep Monoclonal

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Lnpep Monoclonal information

FITC*Monoclonal Mouse Anti- Human IgM

C030601-1ml 1ml
EUR 424.8

FITC*Monoclonal Mouse Anti- Human Fab

C030603-10ml 10ml
EUR 2148

FITC*Monoclonal Mouse Anti- Human Fab

C030603-1ml 1ml
EUR 424.8

FITC*Monoclonal Mouse Anti- Human IgA

C030649-10ml 10ml
EUR 2148

FITC*Monoclonal Mouse Anti- Human IgA

C030649-1ml 1ml
EUR 373.2

Human LNPEP shRNA Plasmid

20-abx952716
  • EUR 961.20
  • EUR 1345.20
  • 150 µg
  • 300 µg

FITC*Monoclonal Mouse Anti- Human IgG2

C030645-10ml 10ml
EUR 3162

FITC*Monoclonal Mouse Anti- Human IgG2

C030645-1ml 1ml
EUR 525.6

FITC*Monoclonal Mouse Anti- Human IgG3

C030646-10ml 10ml
EUR 3162

FITC*Monoclonal Mouse Anti- Human IgG3

C030646-1ml 1ml
EUR 525.6

FITC*Monoclonal Mouse Anti- Human IgG4

C030647-10ml 10ml
EUR 3162

FITC*Monoclonal Mouse Anti- Human IgG4

C030647-1ml 1ml
EUR 525.6

FITC*Monoclonal Mouse Anti- Human IgG1

C030648-10ml 10ml
EUR 3162

FITC*Monoclonal Mouse Anti- Human IgG1

C030648-1ml 1ml
EUR 525.6

BIOTIN*Monoclonal Mouse Anti- Human FC

C030802-10ml 10ml
EUR 2148

BIOTIN*Monoclonal Mouse Anti- Human FC

C030802-1ml 1ml
EUR 373.2

Rat Anti Human Cd8 Monoclonal Antibody

CABT-45277RH 0.2 mg
EUR 889.2

Recent Posts

Tags

December 2023
M T W T F S S
 123
45678910
11121314151617
18192021222324
25262728293031

Categories