Humanized Monoclonal (humanized/xolair biosimilar) Anti-Human IgE, aff pure
10164-M	Alpha Diagnostics	100 ul	EUR 578.4

Human IgG antibody Laboratories manufactures the rat cell line for humanized monoclonal antibody reagents distributed by Genprice. The Rat Cell Line For Humanized Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact rat Antibody. Other Rat products are available in stock. Specificity: Rat Category: Cell Group: Line For

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Line For information

Anti-CD6 (Itolizumab), Humanized Antibody
A2164-100	Biovision	100 µg	EUR 612

Anti-HER2 (Pertuzumab), Humanized Antibody
A2111-100	Biovision	100 µg	EUR 612

Anti-IL5 (Mepolizumab), Humanized Antibody
A2158-100	Biovision	100 µg	EUR 612

Anti-RSV (Palivizumab), Humanized Antibody
A2166-100	Biovision	100 µg	EUR 636

Anti-CCR5 (Leronlimab), Humanized Antibody
A2181-100	Biovision	100 µg	EUR 612

Anti-HER2 (Trastuzumab), humanized Antibody
A1046-100	Biovision	each	EUR 601.2

Anti-EGFR (Panitumumab), humanized antibody
A1050-100	Biovision	each	EUR 601.2

Anti-VEGF (Bevacizumab), humanized Antibody
A1045-100	Biovision	each	EUR 601.2

Anti-CD20 (Obinutuzumab), Humanized Antibody
A2180-100	Biovision	100 µg	EUR 612

Anti-IL-5 (Reslizumab), Humanized Antibody
A2167-100	Biovision	100 µg	EUR 612

pgRNA- humanized
PVT10951	Lifescience Market	2 ug	EUR 361.2

Anti-CTLA-4 (Iplimumab), Humanized Antibody
A2110-100	Biovision	100 µg	EUR 612

Anti-PD-1 (Toripalimab), Humanized Antibody
A2161-100	Biovision	100 µg	EUR 612

Anti-PD-1 (Camrelizumab) humanized Antibody
A2132-100	Biovision	100 µg	EUR 636

Anti-Dabigratan (Idarucizumab), Humanized Antibody
A2169-100	Biovision	100 µg	EUR 612

Anti-PD-L1 (Atezolizumab), humanized Antibody
A1305-100	Biovision	each	EUR 601.2

Anti-PD-1 (Pembrolizumab), humanized Antibody
A1306-100	Biovision	each	EUR 601.2