Fibroblast growth factor 4

FGF receptors (FGFRs) are involved in the pathogenesis

fallback-image

Rat Cell Line For Humanized Monoclonal Antibody

Humanized Monoclonal (humanized/xolair biosimilar) Anti-Human IgE, aff pure

10164-M 100 ul
EUR 578.4

Human IgG antibody Laboratories manufactures the rat cell line for humanized monoclonal antibody reagents distributed by Genprice. The Rat Cell Line For Humanized Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact rat Antibody. Other Rat products are available in stock. Specificity: Rat Category: Cell Group: Line For

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Line For information

Anti-CD6 (Itolizumab), Humanized Antibody

A2164-100 100 µg
EUR 612

Anti-HER2 (Pertuzumab), Humanized Antibody

A2111-100 100 µg
EUR 612

Anti-IL5 (Mepolizumab), Humanized Antibody

A2158-100 100 µg
EUR 612

Anti-RSV (Palivizumab), Humanized Antibody

A2166-100 100 µg
EUR 636

Anti-CCR5 (Leronlimab), Humanized Antibody

A2181-100 100 µg
EUR 612

Anti-HER2 (Trastuzumab), humanized Antibody

A1046-100 each
EUR 601.2

Anti-EGFR (Panitumumab), humanized antibody

A1050-100 each
EUR 601.2

Anti-VEGF (Bevacizumab), humanized Antibody

A1045-100 each
EUR 601.2

Anti-CD20 (Obinutuzumab), Humanized Antibody

A2180-100 100 µg
EUR 612

Anti-IL-5 (Reslizumab), Humanized Antibody

A2167-100 100 µg
EUR 612

pgRNA- humanized

PVT10951 2 ug
EUR 361.2

Anti-CTLA-4 (Iplimumab), Humanized Antibody

A2110-100 100 µg
EUR 612

Anti-PD-1 (Toripalimab), Humanized Antibody

A2161-100 100 µg
EUR 612

Anti-PD-1 (Camrelizumab) humanized Antibody

A2132-100 100 µg
EUR 636

Anti-Dabigratan (Idarucizumab), Humanized Antibody

A2169-100 100 µg
EUR 612

Anti-PD-L1 (Atezolizumab), humanized Antibody

A1305-100 each
EUR 601.2

Anti-PD-1 (Pembrolizumab), humanized Antibody

A1306-100 each
EUR 601.2

Recent Posts

Tags

December 2023
M T W T F S S
 123
45678910
11121314151617
18192021222324
25262728293031

Categories