Humanized Monoclonal (humanized/xolair biosimilar) Anti-Human IgE, aff pure |
10164-M |
Alpha Diagnostics |
100 ul |
EUR 578.4 |
Human IgG antibody Laboratories manufactures the rat cell line for humanized monoclonal antibody reagents distributed by Genprice. The Rat Cell Line For Humanized Monoclonal Antibody reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact rat Antibody. Other Rat products are available in stock. Specificity: Rat Category: Cell Group: Line For
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 482.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 470.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Line For information
Anti-CD6 (Itolizumab), Humanized Antibody |
A2164-100 |
Biovision |
100 µg |
EUR 612 |
Anti-HER2 (Pertuzumab), Humanized Antibody |
A2111-100 |
Biovision |
100 µg |
EUR 612 |
Anti-IL5 (Mepolizumab), Humanized Antibody |
A2158-100 |
Biovision |
100 µg |
EUR 612 |
Anti-RSV (Palivizumab), Humanized Antibody |
A2166-100 |
Biovision |
100 µg |
EUR 636 |
Anti-CCR5 (Leronlimab), Humanized Antibody |
A2181-100 |
Biovision |
100 µg |
EUR 612 |
Anti-HER2 (Trastuzumab), humanized Antibody |
A1046-100 |
Biovision |
each |
EUR 601.2 |
Anti-EGFR (Panitumumab), humanized antibody |
A1050-100 |
Biovision |
each |
EUR 601.2 |
Anti-VEGF (Bevacizumab), humanized Antibody |
A1045-100 |
Biovision |
each |
EUR 601.2 |
Anti-CD20 (Obinutuzumab), Humanized Antibody |
A2180-100 |
Biovision |
100 µg |
EUR 612 |
Anti-IL-5 (Reslizumab), Humanized Antibody |
A2167-100 |
Biovision |
100 µg |
EUR 612 |
Anti-CTLA-4 (Iplimumab), Humanized Antibody |
A2110-100 |
Biovision |
100 µg |
EUR 612 |
Anti-PD-1 (Toripalimab), Humanized Antibody |
A2161-100 |
Biovision |
100 µg |
EUR 612 |
Anti-PD-1 (Camrelizumab) humanized Antibody |
A2132-100 |
Biovision |
100 µg |
EUR 636 |
Anti-Dabigratan (Idarucizumab), Humanized Antibody |
A2169-100 |
Biovision |
100 µg |
EUR 612 |
Anti-PD-L1 (Atezolizumab), humanized Antibody |
A1305-100 |
Biovision |
each |
EUR 601.2 |
Anti-PD-1 (Pembrolizumab), humanized Antibody |
A1306-100 |
Biovision |
each |
EUR 601.2 |